PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0660s0033.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 464aa    MW: 51268.3 Da    PI: 7.3681
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0660s0033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72e-32208265260
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          dDgynWrKYGqK+vk+se+prsYY+Ct++gCp+kkkvers  +++++ei+Y+g+Hnh+k
  Kalax.0660s0033.1.p 208 DDGYNWRKYGQKQVKSSENPRSYYKCTFPGCPTKKKVERSL-EGEITEIVYKGSHNHPK 265
                          8****************************************.***************85 PP

2WRKY104.84.8e-33376434159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Cts+gC+v+k+ver+++d ++v++tYeg+Hnh+
  Kalax.0660s0033.1.p 376 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSQGCTVRKHVERASHDLRAVITTYEGKHNHD 434
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-28195266IPR003657WRKY domain
SuperFamilySSF1182904.05E-25201266IPR003657WRKY domain
PROSITE profilePS5081123.307202266IPR003657WRKY domain
SMARTSM007744.1E-35207265IPR003657WRKY domain
PfamPF031066.7E-25208264IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.6E-37361436IPR003657WRKY domain
SuperFamilySSF1182903.66E-29368436IPR003657WRKY domain
PROSITE profilePS5081138.871371436IPR003657WRKY domain
SMARTSM007741.4E-38376435IPR003657WRKY domain
PfamPF031062.8E-25377434IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MAAASGSLDT SANFPFSFST SFMNSSFSDL LNFPAAVTVE DDSSLLLNGS VNRGVPKFKS  60
LHPPSLLPVS PPPTSPSSYF AFPPGLSPSD LLDSPVLLSS SDLLQSPTTG SFPAALSYNW  120
GTLSTQKNAK QEDSRPQNRN NLNNGYSDFT FQPESRTVSA LDQQQPWTSG SRPSEQKKDD  180
ISYEQATGDI ADYQQAQTQS MREARRSDDG YNWRKYGQKQ VKSSENPRSY YKCTFPGCPT  240
KKKVERSLEG EITEIVYKGS HNHPKPKSTR RLSSNCFQPI SAQPMHQIDG DVPERSFGSQ  300
VAPNQSDQSA ATPENSSVSV DDDDRSRVGG NELDEDEPDA KRWKMETGGE MMSATGCRAV  360
QEPRVVVQTT SDIDILDDGY RWRKYGQKVV KGNPNPRSYY KCTSQGCTVR KHVERASHDL  420
RAVITTYEGK HNHDVPAARG SGSHGRHQQK HGCHENFQRL IHN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-37198437878Probable WRKY transcription factor 4
2lex_A7e-37198437878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017012.11e-152WRKY DNA-binding protein 33 isoform 1
SwissprotQ8S8P51e-105WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0M4PNU91e-156A0A0M4PNU9_9MAGN; Transcription factor WRKY33
STRINGGLYMA02G39870.11e-150(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-100WRKY DNA-binding protein 33